TBLASTN 2.2.10 [Oct-19-2004] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= b0215 name description (243 letters) Database: vc 344 sequences; 4,053,984 total letters Searching.done Score E Sequences producing significant alignments: (bits) Value embl|AE004295|AE004295 Vibrio cholerae O1 biovar eltor str. N169... 293 1e-80 embl|AE004208|AE004208 Vibrio cholerae O1 biovar eltor str. N169... 40 3e-04 embl|AE004233|AE004233 Vibrio cholerae O1 biovar eltor str. N169... 27 1.4 embl|AE004331|AE004331 Vibrio cholerae O1 biovar eltor str. N169... 27 1.8 embl|AE004119|AE004119 Vibrio cholerae O1 biovar eltor str. N169... 26 3.1 embl|AE004340|AE004340 Vibrio cholerae O1 biovar eltor str. N169... 25 5.3 embl|AE004160|AE004160 Vibrio cholerae O1 biovar eltor str. N169... 25 6.9 embl|AE004396|AE004396 Vibrio cholerae O1 biovar eltor str. N169... 25 9.0 >embl|AE004295|AE004295 Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, section 203 of 251 of the complete chromosome. Length = 9973 Score = 293 bits (749), Expect = 1e-80 Identities = 144/238 (60%), Positives = 185/238 (77%), Gaps = 1/238 (0%) Frame = -1 Query: 7 RQIVLDTETTGMNQIGA-HYEGHKIIEIGAVEVVNRRLTGNNFHVYLKPDRLVDPEAFGV 65 R +VLDTETTGMN+ G HYEGH+IIEIGAVE++NR+LTG +FHVYLKPDR + EA V Sbjct: 4762 RIVVLDTETTGMNREGGPHYEGHRIIEIGAVEIINRKLTGRHFHVYLKPDRDIQLEAIEV 4583 Query: 66 HGIADEFLLDKPTFAEVADEFMDYIRGAELVIHNAAFDIGFMDYEFSLLKRDIPKTNTFC 125 HGI DEFL DKP + +V +EF+D+I+GAELV HNA FD+GFMDYEF+ L I KT+ FC Sbjct: 4582 HGITDEFLKDKPEYKDVHEEFVDFIKGAELVAHNAPFDVGFMDYEFAKLGGAIGKTSDFC 4403 Query: 126 KVTDSLAVARKMFPGKRNSLDALCARYEIDNSKRTLHGALLDAQILAEVYLAMTGGQTSM 185 KVTD+LA+A+++FPGKRN+LD LC RY IDNS RTLHGALLDA+ILA+VYL MTGGQTS+ Sbjct: 4402 KVTDTLAMAKRIFPGKRNNLDILCERYGIDNSHRTLHGALLDAEILADVYLLMTGGQTSL 4223 Query: 186 AFAMEGETXXXXGEATIQRIVRQASKLRVVFATDEEIAAHEARLDLVQKKGGSCLWRA 243 F+ + +++R + L+V+ A+ +E+ AH+ RLD+V K G+CLWR+ Sbjct: 4222 QFSSVTQNSGELSAESLKRARSERKALKVLAASADELQAHQDRLDIV-AKSGTCLWRS 4052 >embl|AE004208|AE004208 Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, section 116 of 251 of the complete chromosome. Length = 10254 Score = 39.7 bits (91), Expect = 3e-04 Identities = 43/181 (23%), Positives = 76/181 (41%), Gaps = 12/181 (6%) Frame = -2 Query: 9 IVLDTETTGMNQIGAHYEGHKIIEIGAVEVVNRRLTGNNFHVYL-KPDRLVDPEAFGVHG 67 + LD ETTG+N E I+ IG V +R+ + +L KP + ++ E+ HG Sbjct: 8066 VALDFETTGLNA-----EQDAIVSIGLVPFTTQRIFLSQARYWLVKPSQPLEDESIVFHG 7902 Query: 68 IADEFLLDKPTFAEVADEFMDYIRGAELVIHNAAFDIGFMDYEFSLLKRDIPKTNTFCKV 127 I L +V E ++ + G +V+H + F+ + +I V Sbjct: 7901 ITHSELQHAQAPEQVLKELLEALHGKIVVVHFRHIERDFL----RQISLNIWGEAIEFPV 7734 Query: 128 TDSLAVARKMFPGKRNSLDALCAR----YEIDNSKR-------TLHGALLDAQILAEVYL 176 D+L + R++ +R+ + R + S+ + H AL DA AE++ Sbjct: 7733 LDTLEIERQLLDKQRSLWQRIARRPLPSIRLGQSRMRYHLPPYSPHHALTDAIATAELFQ 7554 Query: 177 A 177 A Sbjct: 7553 A 7551 >embl|AE004233|AE004233 Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, section 141 of 251 of the complete chromosome. Length = 14482 Score = 27.3 bits (59), Expect = 1.4 Identities = 11/44 (25%), Positives = 25/44 (56%) Frame = -1 Query: 180 GGQTSMAFAMEGETXXXXGEATIQRIVRQASKLRVVFATDEEIA 223 G + S + +EG+ G +Q++++Q + VFA ++++A Sbjct: 7444 GIELSSSLVIEGDNTLLGGYQAMQQLLQQGISMTAVFACNDDMA 7313 >embl|AE004331|AE004331 Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, section 239 of 251 of the complete chromosome. Length = 13083 Score = 26.9 bits (58), Expect = 1.8 Identities = 17/54 (31%), Positives = 27/54 (50%), Gaps = 3/54 (5%) Frame = +1 Query: 124 FCKVTDSLAVARKMFPGKRNSLDALCARYEIDNSK---RTLHGALLDAQILAEV 174 FCK ++ V+ K PGK + L +R I ++ RT+ L +I +EV Sbjct: 6769 FCKSVSTIRVSGKAIPGKNSWLARSASRRAICSASCPHRTIFAPLRAKEIASEV 6930 >embl|AE004119|AE004119 Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, section 27 of 251 of the complete chromosome. Length = 11487 Score = 26.2 bits (56), Expect = 3.1 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +2 Query: 69 ADEFLLDKPTFAEVADEFMDYIRGAEL-VIHNAAFDIGFM 107 A EFL+DK + DEF D +R L VI N + F+ Sbjct: 1793 AMEFLIDKLAMTKTNDEFFDAMRRQ*LNVISNTTLAVVFL 1912 >embl|AE004340|AE004340 Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, section 248 of 251 of the complete chromosome. Length = 12224 Score = 25.4 bits (54), Expect = 5.3 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = -2 Query: 82 VADEFMDYIRGAELVIHNAAFDIGFMDYEFSLL 114 +ADE M YI L+IH FMD+E L+ Sbjct: 1711 IADETMTYITPMTLMIH-------FMDHELMLM 1634 >embl|AE004160|AE004160 Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, section 68 of 251 of the complete chromosome. Length = 14261 Score = 25.0 bits (53), Expect = 6.9 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +3 Query: 43 LTGNNFHVYLKPDRLVDPEAFGVHGIADEFL 73 L GN FH++L+P + E +HG +F+ Sbjct: 2298 LLGNTFHLWLRPGQ----EVMKMHGDLHDFM 2378 >embl|AE004396|AE004396 Vibrio cholerae O1 biovar eltor str. N16961 chromosome II, section 53 of 93 of the complete chromosome. Length = 10797 Score = 24.6 bits (52), Expect = 9.0 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = +2 Query: 113 LLKRDIPKTNTFCKVTDSLAVARKMFPGKRNSLDALCARYEIDNS 157 LL+ D +TF K TD +F + LDA+ +YE+ +S Sbjct: 1592 LLRSDAKYLDTFQKNTD-------LFLNLQTELDAIMLKYELGDS 1705 Database: vc Posted date: Sep 29, 2006 7:55 PM Number of letters in database: 4,053,984 Number of sequences in database: 344 Lambda K H 0.322 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 855,720 Number of Sequences: 344 Number of extensions: 9369 Number of successful extensions: 45 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 25 Number of HSP's gapped (non-prelim): 22 length of query: 243 length of database: 1,351,328 effective HSP length: 83 effective length of query: 160 effective length of database: 1,322,776 effective search space: 211644160 effective search space used: 211644160 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 52 (24.6 bits)